Dipodomys ordii (Ord's kangaroo rat): 105998477 Help Entry 105998477         CDS       T07834                                  Symbol Cldn4 Name (RefSeq) claudin-4   KO K06087   claudin Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord03272   Virion - Hepatitis viruses dord04382   Cornified envelope formation dord04514   Cell adhesion molecules dord04530   Tight junction dord04670   Leukocyte transendothelial migration dord05160   Hepatitis C Brite KEGG Orthology (KO) [BR:dord00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     105998477 (Cldn4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     105998477 (Cldn4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     105998477 (Cldn4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     105998477 (Cldn4)   09158 Development and regeneration    04382 Cornified envelope formation     105998477 (Cldn4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     105998477 (Cldn4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dord03037]     105998477 (Cldn4)    04147 Exosome [BR:dord04147]     105998477 (Cldn4)    04515 Cell adhesion molecules [BR:dord04515]     105998477 (Cldn4) Cilium and associated proteins [BR:dord03037]  Other cilia and associated proteins   Stereociliary proteins    105998477 (Cldn4) Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    105998477 (Cldn4)   Exosomal proteins of colorectal cancer cells    105998477 (Cldn4) Cell adhesion molecules [BR:dord04515]  Immunoglobulin superfamily   L1 family    105998477 (Cldn4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 L_HMGIC_fpl Clc-like Motif Other DBs NCBI-GeneID:  105998477 NCBI-ProteinID:  XP_012888646 Ensembl:  ENSDORG00000007737 UniProt:  A0A1S3GIM8 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MASMGLQMLGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALIVISIIVAALALLLSIVGGKCTNCVEDETTKAKIMIV SGVVFLLACLLVIVPISWTAHNIIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGAL LCCSCPPRQDKPYSAKYSAARSAPASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcctccatgggcctgcagatgctaggcattgcgctggccgtgctgggctggctgggc gccatcctgagctgcgcgctgcccatgtggcgcgtgacggcctttatcggcagcaacatt gtcacggcgcagaccagctgggagggactgtggatgaactgcgtggtgcagagcactggg cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcc cgtgcgctcatcgtcatcagcatcattgtggccgccctggctctgctgctgtcgatcgtg gggggcaaatgtaccaactgcgtggaagacgagaccaccaaagccaagatcatgatcgtg tcaggagtggtgttcctgctggcctgcctcctggtcattgtgcccatttcctggacggcg cacaacatcatccgagacttctacaaccccctggtggcatcagggcagaagcgggagatg ggagcttctctgtacatcggctgggcagcgtcagggctactgttgcttgggggggccctg ctgtgctgcagctgcccgccccggcaggacaagccctactcagccaagtactcggccgcc cgctccgccccggccagcaactatgtgtga

DBGET integrated database retrieval system