Dipodomys ordii (Ord's kangaroo rat): 105999606 Help Entry 105999606         CDS       T07834                                  Symbol Mras Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04010   MAPK signaling pathway dord04014   Ras signaling pathway dord04015   Rap1 signaling pathway dord04072   Phospholipase D signaling pathway dord04137   Mitophagy - animal dord04140   Autophagy - animal dord04218   Cellular senescence dord04371   Apelin signaling pathway dord04625   C-type lectin receptor signaling pathway dord04810   Regulation of actin cytoskeleton dord05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105999606 (Mras)    04014 Ras signaling pathway     105999606 (Mras)    04015 Rap1 signaling pathway     105999606 (Mras)    04371 Apelin signaling pathway     105999606 (Mras)    04072 Phospholipase D signaling pathway     105999606 (Mras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105999606 (Mras)    04137 Mitophagy - animal     105999606 (Mras)   09143 Cell growth and death    04218 Cellular senescence     105999606 (Mras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105999606 (Mras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105999606 (Mras)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105999606 (Mras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:dord04031]     105999606 (Mras) GTP-binding proteins [BR:dord04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105999606 (Mras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 Septin AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  105999606 NCBI-ProteinID:  XP_012890127 Ensembl:  ENSDORG00000025032 UniProt:  A0A1S3GQ89 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDSQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNISYIETSAKDPPLNVDKAFHDLVRVIRQQIP DKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcgaccagcgcagtccccagcgacaatctccccacgtacaagctcgtggtggtgggg gacggtggggtgggcaagagcgccctcaccatccagttcttccagaagatcttcgtaccc gactacgaccccaccatcgaagactcctacctgaagcacacagagatcgacagccagtgg gccatcttggatgttctggacacggccggacaggaggagttcagcgccatgcgggagcag tacatgcgcaccggggacggcttcctcatcgtctactccgtcaccgacaaggccagcttc gaacacgtggaccgcttccaccagctcatcctgcgcgtcaaggacagggagtcctttccc atgatcctcgtggccaacaaggtggatttgatgcatctgcggaaaatcaccagagagcaa gggaaagagatggcgactaaacacaatatttcgtacatagaaaccagcgccaaggacccg cctctcaacgtggacaaagccttccatgacctggtcagagtgatcaggcaacagattcca gataaaagccagaagaaaaagaagaaaaccaaatggcggggagaccgggccaccggtacc cacaaactccagtgtgtgatcttgtga

DBGET integrated database retrieval system