Dipodomys ordii (Ord's kangaroo rat): 105999701 Help Entry 105999701         CDS       T07834                                  Symbol Sst Name (RefSeq) somatostatin   KO K05237   somatostatin Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04024   cAMP signaling pathway dord04080   Neuroactive ligand-receptor interaction dord04081   Hormone signaling dord04935   Growth hormone synthesis, secretion and action dord04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     105999701 (Sst)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105999701 (Sst)    04081 Hormone signaling     105999701 (Sst)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     105999701 (Sst)   09154 Digestive system    04971 Gastric acid secretion     105999701 (Sst)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     105999701 (Sst) Cytokines and neuropeptides [BR:dord04052]  Neuropeptides   GPCR binding    105999701 (Sst) SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin Motif Other DBs NCBI-GeneID:  105999701 NCBI-ProteinID:  XP_012890237 Ensembl:  ENSDORG00000029671 UniProt:  A0A1S3GQJ8 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAAISIILALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctgcagtgcgcgctggccgcgatctccatcatcctggccctggga ggtgtcaccggtgcgccctcggaccccaggctccgtcagtttctgcagaagtctctggct gctgctgcaggaaagcaggaactggccaagtatttcttggcagagctgctgtctgagccc aaccagactgagaatgatgccctggaacctgaagatctgccccaggctgccgagcaggat gagatgaggctggagctgcagagatctgcaaactcaaacccagcgatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagacgttcacatcctgttag

DBGET integrated database retrieval system