Dipodomys ordii (Ord's kangaroo rat): 106002508 Help Entry 106002508         CDS       T07834                                  Symbol Pfn3 Name (RefSeq) profilin-3   KO K05759   profilin Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04015   Rap1 signaling pathway dord04810   Regulation of actin cytoskeleton dord05014   Amyotrophic lateral sclerosis dord05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     106002508 (Pfn3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106002508 (Pfn3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106002508 (Pfn3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106002508 (Pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dord04131]     106002508 (Pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:dord04812]     106002508 (Pfn3)    04147 Exosome [BR:dord04147]     106002508 (Pfn3) Membrane trafficking [BR:dord04131]  Others   Actin-binding proteins    Others     106002508 (Pfn3) Cytoskeleton proteins [BR:dord04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      106002508 (Pfn3) Exosome [BR:dord04147]  Exosomal proteins   Proteins found in most exosomes    106002508 (Pfn3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  106002508 NCBI-ProteinID:  XP_012892829 UniProt:  A0A1S3GX33 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MGDWKGYISAVLRDPRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRDTFL HAGLSLAGRRCCVIRDFLLADGDGVLD NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgggggactggaagggctacatcagcgccgtgctgcgggacccgcgcatcgacgacgtg gccatcgtgggccactcggacaaccgctgcgtgtgggcctcccgcccggggggcctgctg gccgccatctccccacaggaggtgggcgtgctcacgggccccgaccgcgacaccttcctg cacgccggcctgagcctggcgggccgccgctgctgcgtcatccgcgacttcctgctggcc gatggcgacggcgtgctggac

DBGET integrated database retrieval system