Dipodomys ordii (Ord's kangaroo rat): 106003099 Help Entry 106003099         CDS       T07834                                  Symbol H3f3b Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04613   Neutrophil extracellular trap formation dord05034   Alcoholism dord05202   Transcriptional misregulation in cancer dord05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:dord00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106003099 (H3f3b)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     106003099 (H3f3b)   09163 Immune disease    05322 Systemic lupus erythematosus     106003099 (H3f3b)   09165 Substance dependence    05034 Alcoholism     106003099 (H3f3b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dord03036]     106003099 (H3f3b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dord04147]     106003099 (H3f3b) Chromosome and associated proteins [BR:dord03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106003099 (H3f3b) Exosome [BR:dord04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106003099 (H3f3b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  106003099 NCBI-ProteinID:  XP_012893322 Ensembl:  ENSDORG00000024467 UniProt:  A0A1S3GZE3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaaatccactggtgggaaggccccccgcaagcag ctggccaccaaggctgccaggaaaagcgcgccctctaccggcggggtgaagaagccccat cgctacaggcctggcactgtggctcttcgagagattcgtcgttatcagaaatccactgag cttctcatccgaaagctgcctttccagaggttggtgagagagattgcccaggattttaaa acggacctgaggtttcagagtgcggccatcggtgcgcttcaggaggctagtgaagcgtac ctggtgggtttgtttgaagataccaatctgtgtgccatccacgccaagagagtcaccatc atgcccaaagacatccaattggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system