Dipodomys ordii (Ord's kangaroo rat): 106003207 Help Entry 106003207         CDS       T07834                                  Symbol Nppc Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism dord  Dipodomys ordii (Ord's kangaroo rat) Pathway dord04022   cGMP-PKG signaling pathway dord04081   Hormone signaling dord04270   Vascular smooth muscle contraction dord05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:dord00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     106003207 (Nppc)   09133 Signaling molecules and interaction    04081 Hormone signaling     106003207 (Nppc)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     106003207 (Nppc)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106003207 (Nppc)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dord04052]     106003207 (Nppc) Cytokines and neuropeptides [BR:dord04052]  Neuropeptides   Unclassified    106003207 (Nppc) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  106003207 NCBI-ProteinID:  XP_012893495 Ensembl:  ENSDORG00000024139 UniProt:  A0A1S3GXS2 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLWPSEAKPGAPPKAPRTPPGEETAEPQASGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGANKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctcgcctgcgccctgctgctcacgctgctctcgctgtggccc tcggaggccaagcccggggcgccaccaaaggccccgcgaaccccaccaggggaggagacg gccgagccccaggcttcgggcggcggacagaagaagggcgacaagactcccggaggcggc ggcgccaacctcaagggcgaccgatcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcggcgtgggcccgccttctgcacgagcaccccaacgcgcgcaagtacaaagga gccaacaagaagggcttgtccaaaggctgcttcggcctcaagctggaccggatcggctcc atgagcggcctgggatgctag

DBGET integrated database retrieval system