Dolichospermum sp. UHCC 0315A: BMF77_03562 Help Entry BMF77_03562       CDS       T06185                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism dou  Dolichospermum sp. UHCC 0315A Brite KEGG Orthology (KO) [BR:dou00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dou03032]     BMF77_03562 (hup)    03036 Chromosome and associated proteins [BR:dou03036]     BMF77_03562 (hup)    03400 DNA repair and recombination proteins [BR:dou03400]     BMF77_03562 (hup) DNA replication proteins [BR:dou03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BMF77_03562 (hup) Chromosome and associated proteins [BR:dou03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BMF77_03562 (hup) DNA repair and recombination proteins [BR:dou03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BMF77_03562 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QEI42946 UniProt:  A0A5C0DTX3 LinkDB All DBs Position complement(3811919..3812212) Genome browser AA seq 97 aa AA seqDB search MNKGELVDAVAEKASVTKKQADAVLSAAIETIVEAVSSGDKVTLVGFGSFESRERKAREG RNPKTNEKMDIPATRVPAFSAGKLFRERVAPPKEPKE NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaacaagggcgaattagttgatgcggtagcagaaaaggctagtgttaccaagaaacag gctgatgctgttttgagtgctgccatcgaaaccattgtggaagcggtttcttccggtgat aaggtaacattggtaggatttggttcttttgaatcacgggaacgcaaagcccgtgaaggg cgcaaccccaaaaccaacgaaaaaatggacattcccgctaccagagttcccgctttctcc gctgggaaactgtttagagaaagagtagcacccccaaaagagccaaaagagtaa

DBGET integrated database retrieval system