Desulfosarcina ovata subsp. sediminis: DSCO28_21720 Help Entry DSCO28_21720      CDS       T06286                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dov  Desulfosarcina ovata subsp. sediminis Pathway dov01100   Metabolic pathways dov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dov00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSCO28_21720    00074 Mycolic acid biosynthesis     DSCO28_21720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSCO28_21720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBO81606 UniProt:  A0A5K7ZKN7 LinkDB All DBs Position 2363582..2363848 Genome browser AA seq 88 aa AA seqDB search MEKLLAELKEKIVEILNLPDVAPTDIPENEPLVGGPLGIDSIDVLEMVIMIEKDYGVVIN NRELGAKVFATLRSLADYVQTHAAEPAS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaaaactgttggctgaattgaaagaaaaaatcgttgaaatcctgaacctgccggat gtcgcccccacggatatccccgagaatgaaccactggtgggtggaccgctggggatcgac tccattgatgtgctcgagatggtgatcatgattgaaaaggattacggcgtcgtgatcaac aaccgcgaactgggggccaaggtgtttgccaccctgcggtcgctggccgactatgtccag acccacgccgcggagccggccagttga

DBGET integrated database retrieval system