Desulfosarcina ovata subsp. sediminis: DSCO28_48820 Help Entry DSCO28_48820      CDS       T06286                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dov  Desulfosarcina ovata subsp. sediminis Pathway dov01100   Metabolic pathways dov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dov00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSCO28_48820    00074 Mycolic acid biosynthesis     DSCO28_48820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSCO28_48820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBO84316 UniProt:  A0A5K7ZVX7 LinkDB All DBs Position 5552125..5552379 Genome browser AA seq 84 aa AA seqDB search MTLQTQLKQILVTELNIRDIPPETIDDDEPIFGDRLGLDSIDALEMVYQVEQHFGISIKD KNEARTALQTINTLTAYITARLPN NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccttacagacccaactcaaacagatactggtgaccgagctgaatatccgcgacatc ccgccggagaccatcgacgacgatgaaccgattttcggtgaccgcctggggctggactcc atcgatgcattggagatggtttaccaggtggaacagcattttggcatctccatcaaggac aaaaatgaggcccgtacggccctgcagaccatcaacaccctgacggcctacatcacggcc cgtctgccgaactga

DBGET integrated database retrieval system