Desulfosarcina ovata subsp. sediminis: DSCO28_49920 Help Entry DSCO28_49920      CDS       T06286                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dov  Desulfosarcina ovata subsp. sediminis Pathway dov01100   Metabolic pathways dov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dov00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSCO28_49920 (acpP)    00074 Mycolic acid biosynthesis     DSCO28_49920 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSCO28_49920 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  BBO84426 UniProt:  A0A5K7ZW73 LinkDB All DBs Position complement(5669721..5669948) Genome browser AA seq 75 aa AA seqDB search MSAEDKVKKIIAEKLSVDIAEVVPEASFVDDLGADSLDLVELIMSMEEEFDVDISDEDAE KMVTVKDAFDYIKNH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtccgcagaagataaagtcaaaaagatcattgccgagaaactcagtgtagatatcgcc gaagtggttcccgaagcctcctttgttgatgaccttggtgcagacagcctggatctcgtg gagttgatcatgtccatggaagaagaattcgatgtggatatttccgatgaagacgcagaa aagatggtgaccgtcaaagacgccttcgactacatcaaaaaccactga

DBGET integrated database retrieval system