Devosia oryziradicis: JI749_14140 Help Entry JI749_14140       CDS       T09885                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism doy  Devosia oryziradicis Pathway doy01100   Metabolic pathways doy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:doy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JI749_14140    00074 Mycolic acid biosynthesis     JI749_14140   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JI749_14140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  QQR35481 UniProt:  A0ABX7BUL5 LinkDB All DBs Position complement(2824792..2825028) Genome browser AA seq 78 aa AA seqDB search MSDVADRVRKIVVEHLNVDAEKVVEKASFIDDLGADSLDQVELVMAFEEEFSVEIPDDAA ESIQTFGDAVSFLTKAVG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgctgatcgggtccgcaagatcgttgtggaacacctcaatgtggatgcc gagaaggttgtcgaaaaggccagcttcatcgacgatctgggcgccgactcccttgaccag gttgaactggtgatggcgttcgaagaagaattctcggtcgaaatccccgatgacgccgcc gagtcgatccagactttcggcgacgccgtctcgttcctcaccaaggccgtcggctaa

DBGET integrated database retrieval system