KEGG   Deinococcus peraridilitoris: Deipe_0537
Entry
Deipe_0537        CDS       T02381                                 
Name
(GenBank) bacterial cell division membrane protein
  KO
K05837  peptidoglycan glycosyltransferase [EC:2.4.99.28]
Organism
dpd  Deinococcus peraridilitoris
Pathway
dpd00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dpd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Deipe_0537
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dpd01003]
    Deipe_0537
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dpd01011]
    Deipe_0537
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpd03036]
    Deipe_0537
Enzymes [BR:dpd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.28  peptidoglycan glycosyltransferase
     Deipe_0537
Glycosyltransferases [BR:dpd01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   Deipe_0537
Peptidoglycan biosynthesis and degradation proteins [BR:dpd01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   Deipe_0537
Chromosome and associated proteins [BR:dpd03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Deipe_0537
SSDB
Motif
Pfam: FTSW_RODA_SPOVE
Other DBs
NCBI-ProteinID: AFZ66132
UniProt: K9ZZ04
LinkDB
Position
complement(549039..550115)
AA seq 358 aa
MHVAKYDLGLPVLVLLLLGAGLVTVSSVAMSPNLVDQGIFQKQLLGVALAVVPLALLLWA
GRDRIYGAAPYLYVLAVVLLLATFVIGKEVNGQRNWLVLGPLQFQPLELAKLSLIVLLPL
VMRGGYQGVRSYFWPLLLFLPVLGLVVKEDFGGGMVLAGMLACMLIVWRIPLWHVLLVVL
VIGVAFPTVVYPRLKPYQQSRLTIFVNPYEDPKGAGYHQIQSTIAIGSGGMQGKGYGNGT
QTHNGFVYSQHSDFVFASWAEEQGFVGAVALLGIFGALFWRLAGMSSDLTRPQDQLLFAG
ILGQLGVQTVENIGASLSMLPLTGITLPLVSYGLSSLVSVLVTLGLAYVIYRDRLEQI
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcacgtggcgaagtacgatctcggcctgccggtgctggtgctgttgctgctcggagcg
ggtctggtgaccgtgagcagcgtggcgatgtctcccaatctggttgaccagggaattttt
cagaagcagctcctgggtgtggccctggcggtcgtgccgcttgcactgctgctgtgggcg
ggccgggaccggatttatggcgcggcgccgtatctgtatgtactcgcggtggtgctgttg
ctggccacctttgtgatcggcaaggaagtgaacgggcagcggaactggctggtgctgggc
ccgttgcagtttcaaccgctcgaacttgccaagctgtcgctgatcgtgctgctgccgctg
gtgatgcgtggcggctatcagggcgtgcggtcgtatttctggccgctgctgctctttctg
ccggtgctggggctggtggtcaaagaggacttcggcggtggcatggtgctggcgggcatg
ctggcgtgcatgctgatcgtgtggcgtattccgttgtggcacgtgctgttggtcgtgctg
gtcatcggtgtggcgttccctaccgtcgtctacccccgactcaaaccgtaccagcagagc
cgcctgaccattttcgtcaatccctacgaagaccccaagggcgcgggctaccaccagatc
cagtccaccatcgccattggctcgggcgggatgcagggcaaggggtacgggaacggtacc
cagacccacaacggttttgtgtacagccagcacagcgatttcgtgttcgcttcctgggcc
gaggagcagggcttcgtgggtgccgtggcgctgctgggcatttttggagcactgttctgg
cggctggcggggatgtccagcgacctgacacgaccacaagatcagctgctttttgccggc
attctgggacagctgggtgtgcagaccgtggagaacatcggcgcttcgctttccatgttg
ccgctcaccggcatcaccctgccgctggtcagctatggcctcagttcgctggtttcagtg
ctcgtgacgttgggcctggcgtacgtgatctaccgcgaccgcctggaacagatctga

DBGET integrated database retrieval system