Deinococcus peraridilitoris: Deipe_1100 Help Entry Deipe_1100        CDS       T02381                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dpd  Deinococcus peraridilitoris Pathway dpd01100   Metabolic pathways dpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Deipe_1100    00074 Mycolic acid biosynthesis     Deipe_1100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Deipe_1100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AFZ66662 UniProt:  L0A0I1 LinkDB All DBs Position complement(1120797..1121027) Genome browser AA seq 76 aa AA seqDB search METFDQVKEVIVEKLGVDADKVTPEARFVEDLGADSLETVELIMGLEDKFGISISDEDAE GIRTVQAAVDYIGAKQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaaacattcgaccaagtcaaagaagtgatcgtggaaaagctcggcgtggacgccgac aaggtcacgcccgaagcgcgctttgtggaggacctcggcgccgacagcctggagaccgtg gagctgatcatgggtctcgaggacaagttcggtatctcgatcagcgacgaggacgccgaa ggtatccgtaccgtgcaggcagccgtcgactacatcggcgccaagcagtaa

DBGET integrated database retrieval system