Drosophila persimilis: 113566445 Help Entry 113566445         CDS       T01063                                  Name (RefSeq) probable insulin-like peptide 2   KO K04526   insulin Organism dpe  Drosophila persimilis Pathway dpe04068   FoxO signaling pathway dpe04081   Hormone signaling dpe04140   Autophagy - animal dpe04150   mTOR signaling pathway dpe04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dpe00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     113566445    04150 mTOR signaling pathway     113566445   09133 Signaling molecules and interaction    04081 Hormone signaling     113566445  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113566445  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     113566445  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dpe04052]     113566445 Cytokines and neuropeptides [BR:dpe04052]  Neuropeptides   Unclassified    113566445 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  113566445 NCBI-ProteinID:  XP_026847822 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MSKIVSVSLVLVLLAVTLSCGVADSSMYMRDQSNHVLCSYKLNEMLSLVCKEFNSVLPHK RGMPAATELDPLDPIQYVEDKEGTASDVLPYPLFGGRFYGGEEALSSLAAVRRRTRQGIA DRCCRKPCDISVLTEYCSIPNY NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgagcaagattgtgtcggtatccctggtcctggtgctcctggctgtgaccctgtcgtgt ggcgtcgcggacagcagcatgtacatgcgggaccagagcaaccatgtcctgtgcagctac aagctgaacgagatgctgtccctggtgtgcaaggagttcaacagtgtcctgccccacaag cgaggcatgcccgccgccaccgagctggatccgctcgatcccatccagtacgtggaggac aaggagggcacagcctctgatgtactgccctatccgctcttcggtggccgattttacggc ggagaggaggctctaagctccctggccgccgtgcgccgtcgcacccgccagggcatcgcc gatagatgctgccgcaagccttgcgacatatccgttctaacggagtactgctccatcccc aattactaa

DBGET integrated database retrieval system