Drosophila persimilis: 6587262 Help Entry 6587262           CDS       T01063                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism dpe  Drosophila persimilis Pathway dpe04137   Mitophagy - animal dpe04140   Autophagy - animal dpe04142   Lysosome biogenesis dpe04144   Endocytosis dpe04145   Phagosome dpe04148   Efferocytosis Brite KEGG Orthology (KO) [BR:dpe00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     6587262    04145 Phagosome     6587262    04142 Lysosome biogenesis     6587262    04140 Autophagy - animal     6587262    04137 Mitophagy - animal     6587262    04148 Efferocytosis     6587262  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpe04131]     6587262   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpe04147]     6587262    04031 GTP-binding proteins [BR:dpe04031]     6587262 Membrane trafficking [BR:dpe04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     6587262 Exosome [BR:dpe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6587262   Exosomal proteins of other body fluids (saliva and urine)    6587262   Exosomal proteins of colorectal cancer cells    6587262   Exosomal proteins of bladder cancer cells    6587262 GTP-binding proteins [BR:dpe04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     6587262 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase AAA_16 nSTAND3 Septin SRPRB ATPase_2 TniB Motif Other DBs NCBI-GeneID:  6587262 NCBI-ProteinID:  XP_026841201 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MATRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPEHFPF VVLGNKVDLDNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQTIAKNALEQEAEA EVINDFPDQIILNSQNNRPGNPDNCQC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggccacccgtaagaaatctttgctgaaagtcatcatactgggcgacagcagtgtgggc aagacctcactcatgaatcagtatgtgaacaaacgcttctctaaccaatacaaagcaacg atcggcgccgacttctgcacgaaagaggtggttgtcaacgaccgtgtggtcacaatgcag atttgggatacagctggtcaggaacgcttccagtcactcggcgtggctttctatcgcgga gctgactgctgtgtgctcgtttacgatgtgacggcgcctaactcattcaagaatctcgac tcctggcgcgacgagttcttaatacaggccagtccacgtgatcccgagcatttccccttt gttgtgctaggcaacaaagtggacttggataaccgccaagtgtccacgcgcagggcacaa caatggtgtcaatccaaaaacgatataccctactatgaaacctcagccaaggagggcatc aacgtggagatggcgtttcagactattgccaagaatgcgttggagcaggaggcagaggct gaagttatcaacgatttccccgatcagatcatcttgaattctcaaaataatcgtccagga aaccctgacaactgtcagtgctaa

DBGET integrated database retrieval system