Drosophila persimilis: 6587773 Help Entry 6587773           CDS       T01063                                  Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism dpe  Drosophila persimilis Pathway dpe04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dpe00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6587773  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dpe03037]     6587773 Cilium and associated proteins [BR:dpe03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    6587773 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Chibby Motif Other DBs NCBI-GeneID:  6587773 NCBI-ProteinID:  XP_026840387 FlyBase:  FBgn0161387 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MPLFNKKFESKPIPLRQNRCNIGIPAVAEDLDDFRQISLNLGNKELRFADGIWMHSTRKG DVDDMLRLKKKFRVLEEENNMSNLKMEFMLDLLAEQASELNELKPREKSTFENVKK NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgccgctgttcaacaagaaattcgagtccaagccgataccgctgcgtcagaatcgatgc aatattggcattcctgctgtcgccgaggatcttgatgactttcgccagatttcgctgaat ctgggcaacaaggagctgcgctttgccgatggcatctggatgcactcgacgcgcaagggc gatgtggacgatatgctgcgtctgaaaaagaagttccgtgtcctggaagaggagaacaat atgtccaatttgaagatggaatttatgctggatctactggcggagcaggcatcggaattg aacgaactaaagccgagggaaaagagcacatttgaaaatgtaaagaaataa

DBGET integrated database retrieval system