Drosophila persimilis: 6591113 Help Entry 6591113           CDS       T01063                                  Name (RefSeq) calmodulin isoform X2   KO K02183   calmodulin Organism dpe  Drosophila persimilis Pathway dpe04070   Phosphatidylinositol signaling system dpe04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dpe00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     6591113  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     6591113  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dpe01009]     6591113   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpe04131]     6591113    03036 Chromosome and associated proteins [BR:dpe03036]     6591113   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpe04147]     6591113 Protein phosphatases and associated proteins [BR:dpe01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      6591113 Membrane trafficking [BR:dpe04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     6591113 Chromosome and associated proteins [BR:dpe03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      6591113 Exosome [BR:dpe04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    6591113 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 Caleosin TerB FCaBP_EF-hand DUF5580_M SPEF2_C MotA_activ Fe_hyd_lg_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  6591113 NCBI-ProteinID:  XP_002015815 UniProt:  B4G9V3 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVTMMTSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctgacagaggaacaaatcgccgagttcaaagaggcattctcgctattc gacaaagacggcgatggcaccatcacaacaaaggaattgggaacagtcatgcgctccctg ggacagaatcccacagaggccgagctgcaggacatgataaacgaggtcgatgccgatggc aacggaaccattgatttcccagaattccttaccatgatggcacgcaaaatgaaggacacc gatagcgaagaggagatccgagaagccttcagagtgttcgacaaggacggcaacggcttc atctcagcggccgagctgcgtcacgtgatgacaaatttgggcgagaagttaacagacgag gaggtcgatgagatgatccgcgaggctgatatcgatggtgatggtcaggtcaattacgaa gagttcgtgaccatgatgacatcgaagtga

DBGET integrated database retrieval system