Drosophila persimilis: 6591173 Help Entry 6591173           CDS       T01063                                  Name (RefSeq) diptericin A   KO K20669   diptericin Organism dpe  Drosophila persimilis Pathway dpe04624   Toll and Imd signaling pathway Brite KEGG Orthology (KO) [BR:dpe00001]  09150 Organismal Systems   09151 Immune system    04624 Toll and Imd signaling pathway     6591173  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:dpe02000]     6591173 Transporters [BR:dpe02000]  Other transporters   Pores ion channels [TC:1]    6591173 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Attacin_C Motif Other DBs NCBI-GeneID:  6591173 NCBI-ProteinID:  XP_002016276 UniProt:  B4GB64 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MQSTIVLALLCCIVGAVVAYPAEDMTMPSTPSPRYPLNLQGGGGAQEREGFNFGVRGSEN VWRSDNGRHEIDVNGGYAQRLGGKWGNSEPSYSVGTNYRYRW NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgcagtctacaatcgtcctcgctctgctctgctgcattgtcggtgctgtggtggcatat ccggccgaagacatgacgatgccctcgacgccatcgcctcgctatcccctcaacttgcag ggcggcggcggggcccaggagcgcgaaggattcaactttggagtgcgtggcagcgagaac gtgtggaggagcgacaacggacggcacgagatcgacgtaaacggcggatatgcccagcgt ttgggcggaaagtggggcaactcggagccgagctacagcgttggcaccaactaccgctac agatggtag

DBGET integrated database retrieval system