Drosophila persimilis: 6594920 Help Entry 6594920           CDS       T01063                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism dpe  Drosophila persimilis Brite KEGG Orthology (KO) [BR:dpe00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dpe03037]     6594920 Cilium and associated proteins [BR:dpe03037]  Primary cilia and associated proteins   BBSome    6594920 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  6594920 NCBI-ProteinID:  XP_002020128 FlyBase:  FBgn0151425 UniProt:  B4GP57 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MSEVESELLRKVNEKIDLIEPTTGKLFFEHKTELVFCRPHLMPLKTQALERLEEMHRETA RQLQKKRNNKKITEPHKE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccgaagtggagtctgagctgcttagaaaagtgaatgagaaaatcgatctgattgag cccacaaccggaaaactgtttttcgagcacaaaacagagctggttttctgtaggccgcac ctgatgccgctaaagacgcaggcgctggaacggctagaggaaatgcatcgcgaaactgcg cgtcagctgcaaaagaagcgaaacaataagaaaatcaccgagccccacaaggaatag

DBGET integrated database retrieval system