Drosophila persimilis: 6594964 Help Entry 6594964           CDS       T01063                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dpe  Drosophila persimilis Pathway dpe04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dpe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     6594964  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dpe04121]     6594964    03400 DNA repair and recombination proteins [BR:dpe03400]     6594964 Ubiquitin system [BR:dpe04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      6594964    Cul5 complex      6594964 DNA repair and recombination proteins [BR:dpe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      6594964 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin GABP-alpha Rad60-SLD Motif Other DBs NCBI-GeneID:  6594964 NCBI-ProteinID:  XP_002020332 UniProt:  B4GN18 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQVVDQRLYNQDNDIMEDDSTLQE YGVTVSTAKAQSPAQLGLTFRNDMGDFETLDMTPYSAPPDLPEVMKNQEASNGQEAVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatcagaaggcaaaagacgacgattttcacggatgccaaggag aacactaccgttgccgagctgaaacgtatgattgaaggcattctaaaagtacaagtcgtc gatcagcggttatacaaccaggacaacgacattatggaggatgacagcacgttgcaggag tacggcgtgacggtatccacggcgaaggcacagtcgccggcgcaactgggcttgacattc aggaacgatatgggcgactttgaaacactggatatgacgccatactcagctccacccgac ttaccagaagtgatgaaaaaccaagaagcctcaaacggacaggaggcagtcgcataa

DBGET integrated database retrieval system