Drosophila persimilis: 6596851 Help Entry 6596851           CDS       T01063                                  Name (RefSeq) casein kinase II subunit beta'   KO K03115   casein kinase II subunit beta Organism dpe  Drosophila persimilis Pathway dpe03008   Ribosome biogenesis in eukaryotes dpe03083   Polycomb repressive complex dpe04137   Mitophagy - animal dpe04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dpe00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     6596851   09126 Chromosome    03083 Polycomb repressive complex     6596851  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     6596851  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     6596851  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:dpe03009]     6596851    03036 Chromosome and associated proteins [BR:dpe03036]     6596851 Ribosome biogenesis [BR:dpe03009]  Eukaryotic type   90S particles    Kinase     6596851 Chromosome and associated proteins [BR:dpe03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      6596851 SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Iron_transport Motif Other DBs NCBI-GeneID:  6596851 NCBI-ProteinID:  XP_002022084 UniProt:  B4GU05 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MSNNEKKKCGNEFFTMLNEDYIHDKFNLIFLDTENYRSTLEVIPDLNSRSGSHVGNDHDV DASAEKLCKRIHARFELMLKKFQRAVFAPVCCPICNDVCNLDGALLGTNYSIELFAQRPS LCPYPDGLSDSGAFFV NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgtcgaacaatgaaaaaaagaagtgcggaaacgagttcttcacaatgttgaacgaggac tacatccatgacaagttcaacctgatcttcctggacacggaaaactatcgcagcaccctc gaagtgatccccgacctcaactcccggtcaggttcccatgttggaaatgatcacgatgtg gatgctagcgccgagaagctctgcaaacggatccacgcccgattcgaattgatgctcaag aaattccagagggccgtctttgcccccgtctgctgccccatctgcaacgatgtctgcaac ctggacggcgctttgcttggcacaaactactccattgagctattcgctcaaaggccaagt ttgtgcccatatcccgatggtctgtccgattccggagccttttttgtctga

DBGET integrated database retrieval system