Drosophila persimilis: 6597190 Help Entry 6597190           CDS       T01063                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dpe  Drosophila persimilis Pathway dpe04013   MAPK signaling pathway - fly dpe04145   Phagosome dpe04148   Efferocytosis dpe04310   Wnt signaling pathway dpe04517   IgSF CAM signaling dpe04518   Integrin signaling dpe04620   Toll-like receptor signaling pathway dpe05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dpe00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6597190    04310 Wnt signaling pathway     6597190   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     6597190    04518 Integrin signaling     6597190  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6597190    04148 Efferocytosis     6597190  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     6597190  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6597190  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpe04131]     6597190   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpe04147]     6597190    04031 GTP-binding proteins [BR:dpe04031]     6597190 Membrane trafficking [BR:dpe04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6597190  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6597190   Macropinocytosis    Ras GTPases     6597190  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6597190 Exosome [BR:dpe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6597190   Exosomal proteins of other body fluids (saliva and urine)    6597190   Exosomal proteins of colorectal cancer cells    6597190   Exosomal proteins of bladder cancer cells    6597190 GTP-binding proteins [BR:dpe04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6597190 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  6597190 NCBI-ProteinID:  XP_026845550 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSVPIILVGTKLDLR DDKATIEKLKDKKLTPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV VRRPPRRMCKLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgttgttgttggcgacggagccgtgggcaagacctgcctcctg atcagctacacgaccaatgccttccccggagaatacatcccgacggtgttcgataattac tcggccaacgtgatggtggatgccaagcccatcaatctgggactgtgggatacggccggg caggaggactacgatcggttgcgtccgctctcctacccgcagacggacgtcttcctcatc tgcttctcgctggtcaatcccgcctccttcgagaacgtgcgggccaagtggtaccccgag gtgcgtcaccactgccccagtgtgccgatcattctggtgggcaccaagctggatctgcgc gatgacaaggccaccatcgagaagctcaaggacaagaagctgacgcccatcacctatccg cagggtctggccatggccaaggagatcggagccgtcaagtatctggagtgctcggctctg acccagaagggcctgaagacggtcttcgacgaggccatccgctctgtgctttgtccggtg gtgcgcaggcccccccgtcgcatgtgcaagctgctgtag

DBGET integrated database retrieval system