Drosophila persimilis: 6602823 Help Entry 6602823           CDS       T01063                                  Name (RefSeq) probable insulin-like peptide 1   KO K04526   insulin Organism dpe  Drosophila persimilis Pathway dpe04068   FoxO signaling pathway dpe04081   Hormone signaling dpe04140   Autophagy - animal dpe04150   mTOR signaling pathway dpe04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dpe00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     6602823    04150 mTOR signaling pathway     6602823   09133 Signaling molecules and interaction    04081 Hormone signaling     6602823  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6602823  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     6602823  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dpe04052]     6602823 Cytokines and neuropeptides [BR:dpe04052]  Neuropeptides   Unclassified    6602823 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  6602823 NCBI-ProteinID:  XP_002027825 UniProt:  B4HAE6 LinkDB All DBs Position Unknown AA seq 145 aa AA seqDB search MPSNSQNRLSHRMLGKDTSAITAVQVSRRHWPLVMLIFLAVVQGHVHQLQQGSHKLCGQA LSDAMDVVCAHGYNTLPQKKSSTVDAQDDDAPEYALSPLLSSLYGAEVLIKTRRHRRQRS SGGIYDECCVYSCRYEELASYCLPK NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgccttcaaacagccaaaacagactcagccacaggatgttgggcaaggacacaagtgca ataacggcagtacaggtctccaggcggcactggccgctcgtcatgctgatcttcctggcc gtcgtccagggccatgtccatcagctgcagcagggcagccacaagctgtgcggccaggcc ctgtccgacgccatggacgtggtctgtgcccacggctacaacacgctgccgcagaaaaag agttccacagtggatgcccaagatgatgatgcacccgagtatgcgttgagccctctgctc tccagcctctatggggcagaggtgctcatcaagacgcggcgacatcggagacagcggtca tcgggtggcatctacgacgagtgctgtgtgtactcttgccgctacgaggagctggcctcc tactgcctccccaaataa

DBGET integrated database retrieval system