Dyadobacter pollutisoli: ON006_24875 Help Entry ON006_24875       CDS       T09794                                  Symbol atpC Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism dpf  Dyadobacter pollutisoli Pathway dpf00190   Oxidative phosphorylation dpf01100   Metabolic pathways Module dpf_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:dpf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ON006_24875 (atpC)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:dpf00194]     ON006_24875 (atpC) Photosynthesis proteins [BR:dpf00194]  Photosystem and electron transport system   F-type ATPase [OT]    ON006_24875 (atpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  WAC10968 UniProt:  A0A9E8SJL2 LinkDB All DBs Position 6050690..6050932 Genome browser AA seq 80 aa AA seqDB search MHLEIITPDKKVFAGEATAVTLPGTEGQFQVLNRHAPLVSTLGKGDVVVDTGAAKQNFVI DGGVVEVLNNKVLVLAEAVL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcatttagaaatcattaccccagataaaaaggtatttgccggcgaggcgactgctgtt acattaccgggtaccgaaggacaatttcaggttttgaaccgccacgcaccattggtcagc acgctgggcaaaggagatgtggtagtagataccggagcagccaaacaaaacttcgtcatt gacggtggcgttgtggaagtgctcaataacaaggtattggttttggccgaggctgttttg tag

DBGET integrated database retrieval system