Desulfovibrio piger: DESPIGER_1071 Help Entry DESPIGER_1071     CDS       T04638                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism dpg  Desulfovibrio piger Pathway dpg01100   Metabolic pathways dpg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dpg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DESPIGER_1071    00074 Mycolic acid biosynthesis     DESPIGER_1071   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DESPIGER_1071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  SFV72934 UniProt:  A0A1K1LHJ8 LinkDB All DBs Position I:1146297..1146533 Genome browser AA seq 78 aa AA seqDB search MSEVAAKVTKIIVDQLGVSAEEVKPEASFVEDLGADSLDLTELIMAMEEEFDIEIADDDA QKILKVQDAISYIESKQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagttgcagccaaagtgaccaaaatcatcgtggaccagctgggcgtgagcgct gaagaagtgaagcccgaagcttccttcgtggaagacctgggcgctgactccctggacctg accgaactgatcatggccatggaagaagaattcgacatcgagatcgccgatgacgacgcc cagaagatcctgaaggtgcaggacgccatcagctacatcgaaagcaagcagggctaa

DBGET integrated database retrieval system