Danaus plexippus (monarch butterfly): KGM_200974 Help Entry KGM_200974        CDS       T04344                                  Name (GenBank) Tfb5   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism dpl  Danaus plexippus (monarch butterfly) Pathway dpl03022   Basal transcription factors dpl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dpl00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     KGM_200974   09124 Replication and repair    03420 Nucleotide excision repair     KGM_200974  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dpl03021]     KGM_200974    03400 DNA repair and recombination proteins [BR:dpl03400]     KGM_200974 Transcription machinery [BR:dpl03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      KGM_200974 DNA repair and recombination proteins [BR:dpl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      KGM_200974 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-ProteinID:  OWR47580 UniProt:  A0A212F1G1 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MVNVMKGVLVECDPAMKQFLLHLDETLALGRKFILQDLDETHVFISSDIVETLQARVDDL MDQFSFPVHDKGL NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggtgaatgttatgaaaggtgttcttgtggaatgtgacccagcaatgaagcagttccta ctccacttagatgaaacactggccctcggtagaaaatttatccttcaggatctggatgaa acccatgtgtttatttcatcagatatagttgaaacattacaagctcgtgttgatgatttg atggaccaattcagtttcccagttcacgataaaggtttgtaa

DBGET integrated database retrieval system