Danaus plexippus (monarch butterfly): KGM_204314 Help Entry KGM_204314        CDS       T04344                                  Name (GenBank) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dpl  Danaus plexippus (monarch butterfly) Pathway dpl04013   MAPK signaling pathway - fly dpl04145   Phagosome dpl04148   Efferocytosis dpl04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:dpl00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     KGM_204314    04310 Wnt signaling pathway     KGM_204314  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     KGM_204314    04148 Efferocytosis     KGM_204314  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpl04131]     KGM_204314   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpl04147]     KGM_204314    04031 GTP-binding proteins [BR:dpl04031]     KGM_204314 Membrane trafficking [BR:dpl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     KGM_204314  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     KGM_204314   Macropinocytosis    Ras GTPases     KGM_204314  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     KGM_204314 Exosome [BR:dpl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    KGM_204314   Exosomal proteins of other body fluids (saliva and urine)    KGM_204314   Exosomal proteins of colorectal cancer cells    KGM_204314   Exosomal proteins of bladder cancer cells    KGM_204314 GTP-binding proteins [BR:dpl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     KGM_204314 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-ProteinID:  OWR43241 UniProt:  A0A212EP60 LinkDB All DBs Position Unknown AA seq 168 aa AA seqDB search MVGKTCLLYVYTRNEFPKEYVPTVFDNYVGHITVDGQEIEMTLWDTAGQEDYERLRPLSY NNTHCFLVCYSVGSRSSYENVGHKWYPELKHFSSSVPIVLVATKTDLRASGQAVITTQEG KVLKRKIRAVQLVECSALERENMHEVFEEAVRAALKKKQVTKRTCNFL NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atggttggcaaaacttgccttctctacgtttacactagaaacgaattccctaaagaatac gtaccaacggtatttgacaattatgtaggacacattacggttgatggacaagaaattgaa atgacactctgggacactgccggccaggaagattacgaaagacttagacctttgtcatat aataacacgcattgtttcctggtatgttactcagttgggagtagatcgtcttatgaaaac gttggtcacaaatggtatcctgaattaaaacatttcagttcgtcagtgccaatagttctt gttgctactaaaacagatttaagggcaagcggtcaagcggttattacaactcaagaagga aaagtattaaaaaggaaaataagagcagtccaattggttgaatgttctgctttggaacga gagaatatgcatgaagtattcgaggaggccgtgcgtgctgctctcaagaagaagcaagta acaaaacgaacttgcaatttcctatga

DBGET integrated database retrieval system