KEGG   Danaus plexippus (monarch butterfly): KGM_213017
Entry
KGM_213017        CDS       T04344                                 
Name
(GenBank) cytochrome P450 CYP306A1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dpl  Danaus plexippus (monarch butterfly)
Pathway
dpl00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dpl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    KGM_213017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dpl00199]
    KGM_213017
Enzymes [BR:dpl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     KGM_213017
Cytochrome P450 [BR:dpl00199]
 Cytochrome P450, animal type
  CYP306 family
   KGM_213017
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: OWR52346
UniProt: A0A212FF22
LinkDB
Position
Unknown
AA seq 539 aa
MDVIFLWLVTIVLGFLLLKQLYRWRSLPPGPWGLPVFGYLPFLDPEQPHLTLTKLAERYG
PIYGIDMGSTYAVIISDYKLVREAFAKDVFSGRAPLYLTHGIMRGFGIICSEGARWKDQR
KLVTTWLKSFGMSKHSVSRDKLEKRIASGVHEVVQNLRENNGSPVNLSDMITHSLGNVVN
DIIFGFKYDADDKTWRWFRQIQEEGCHEMGVSAIVNFLPFMRFISPSIQKTMEVLIRGQA
QTHRLYASIIARRRKMLGLQKPAGAERPAHDKLFDEHPEGFIKCTKYSKNASNDEVHFFN
PDVLIPSQDECILDKFLIEQKRRYENKEESAIFVTDEQLHFLLADMFGAGLDTTSVTLSW
FLLYMALYPDEQELVREEILSVYSEECEIDSSKLPKLMAAICETQRIRSIVPVGIPHGCL
QDTYLGNYRIPKGAMIVPLQWAIHMDPNIWEDPHIFKPSRFLDENGKLLKPQEFIPFQTG
KRMCPGDELSRMLTVGFMVQLFRSFRVRLESKPPSTKEMQGKVGVTLSPPHVLFVCDSL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggacgttatattcttatggctcgtaacgatcgtgctgggatttttgttactcaaacaa
ctttatcgatggcggtctttacccccgggcccctggggtctgcctgtatttggataccta
ccatttttagacccagaacaacctcatttgaccttaactaagttggcggagcgttatgga
ccaatttatggcatagacatggggagcacatacgccgttattatttctgattataaatta
gttcgggaagcgtttgccaaagatgttttttctggaagagctccgctatatttgacccat
ggaatcatgagaggctttggcataatttgctctgaaggagctcggtggaaagatcaacgc
aaactagtaacaacttggcttaaaagttttggtatgagcaaacatagcgtatccagagac
aaattagaaaagcgtatagcttctggtgttcatgaagtagttcaaaatcttagggaaaac
aatggaagtcctgttaatttgtcggatatgataacgcattctttgggcaacgttgtgaat
gatattatatttggtttcaaatacgatgccgacgacaagacgtggcgatggttcagacaa
atacaagaagaaggttgccatgaaatgggcgtgtctgctatcgtgaacttccttccgttt
atgagattcatatccccgtctattcaaaagacaatggaagttttaattcgagggcaagcc
caaactcatagattatacgctagcatcatagcccgccggcgaaaaatgcttggtttgcaa
aaacctgctggagctgagcgccctgcacacgataagctgtttgatgaacatcctgagggg
ttcataaaatgcacaaagtatagtaagaatgcatcaaacgacgaagtacatttttttaat
cccgatgtattaattccatcccaggatgaatgcattttggataaattcttgatagaacaa
aaaaggaggtatgaaaataaagaagagagtgcaatttttgtaaccgacgaacagttacat
ttcttgttagctgacatgtttggggcaggacttgatactacgtctgtgacactatcgtgg
tttttactgtacatggctctatatccggatgagcaggaactcgtgcgtgaagaaatatta
tctgtgtattcagaagaatgtgaaatcgacagttcaaaattacctaaacttatggctgcg
atttgcgaaacacaacgaatccggtctatagtacctgtgggtatacctcatggatgtctg
caagatacatatttgggtaattatcgaataccaaaaggtgcaatgatcgtaccgctgcag
tgggcaattcatatggaccctaacatttgggaagatccgcatattttcaaaccaagcaga
ttcctcgacgagaacggcaaattgttgaaaccccaagagtttataccgtttcaaacaggt
aagcgaatgtgccctggcgacgagctttcaagaatgcttacggttggcttcatggttcaa
ttgttccgatcttttcgcgtgcgacttgaatcaaagcccccctcgacaaaggaaatgcaa
ggaaaagttggtgttactttgtcgccacctcatgttcttttcgtttgtgactctttataa

DBGET integrated database retrieval system