Drosophila pseudoobscura: 4814629 Help Entry 4814629           CDS       T01032                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism dpo  Drosophila pseudoobscura Pathway dpo04144   Endocytosis dpo04517   IgSF CAM signaling dpo04518   Integrin signaling dpo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dpo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     4814629    04518 Integrin signaling     4814629  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     4814629  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     4814629  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpo04131]     4814629    03036 Chromosome and associated proteins [BR:dpo03036]     4814629   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpo04147]     4814629    04031 GTP-binding proteins [BR:dpo04031]     4814629 Membrane trafficking [BR:dpo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     4814629  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     4814629   Macropinocytosis    Ras GTPases     4814629 Chromosome and associated proteins [BR:dpo03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     4814629 Exosome [BR:dpo04147]  Exosomal proteins   Exosomal proteins of microglial cells    4814629   Exosomal proteins of breast milk    4814629 GTP-binding proteins [BR:dpo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     4814629 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  4814629 NCBI-ProteinID:  XP_001354570 UniProt:  Q29HY3 A0ABE2UG30 LinkDB All DBs Position X:complement(17402893..17406265) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR DETSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPTKKRKCKFL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccatcaagtgcgtggtcgttggcgacggagccgtgggtaagacctgcctgctc atctcctacacaaccaacaaatttccatcggaatatgtgccaactgtctttgacaattat gcggtgacggtgatgattggcggcgagccctacacactgggcctgttcgatacggccggt caggaggattacgataggctccgcccattgtcctatccgcagaccgatgtctttctcgtc tgcttctcggtggtcagtcccagttcatttgagaatgttaaagagaagtgggttcctgag atcacgcaccattgccagaagacgccattcctgctggtgggcacacagatcgatttgcgc gatgagaccagcacactggagaagctggccaagaacaagcaaaagcccatcaccatggag cagggcgagaagctggccaaagagctgaaggccgtcaaatatgtggagtgctcggctctg acacaaaagggtctgaaaaatgtcttcgatgaggccatactggccgccctggagccacca gaaccaaccaagaaaaggaagtgcaaattcttataa

DBGET integrated database retrieval system