Drosophila pseudoobscura: 4818065 Help Entry 4818065           CDS       T01032                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism dpo  Drosophila pseudoobscura Pathway dpo03030   DNA replication dpo03082   ATP-dependent chromatin remodeling dpo03410   Base excision repair dpo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dpo00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     4818065    03410 Base excision repair     4818065    03420 Nucleotide excision repair     4818065   09126 Chromosome    03082 ATP-dependent chromatin remodeling     4818065  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dpo03032]     4818065    03036 Chromosome and associated proteins [BR:dpo03036]     4818065    03400 DNA repair and recombination proteins [BR:dpo03400]     4818065 Enzymes [BR:dpo01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      4818065 DNA replication proteins [BR:dpo03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     4818065 Chromosome and associated proteins [BR:dpo03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     4818065 DNA repair and recombination proteins [BR:dpo03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       4818065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C Pim DUF6488 CENP-S Motif Other DBs NCBI-GeneID:  4818065 NCBI-ProteinID:  XP_001357421 UniProt:  Q29P03 LinkDB All DBs Position 4:10715478..10716102 Genome browser AA seq 127 aa AA seqDB search MVERIEDLNLPNAVIARLIKEALPDGANVSKEARAAIARAASVFTIFVTSSSTALAHKQN HKTITAKDIMQTLTELDFESFVPSLSQDLEVYRKVVKDKKDSKASKKDASGAADVSASGS GATEEAL NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggttgaacgtattgaggatttgaacctacccaatgcagtgattgcgcggctaatcaag gaggccttgcctgatggggcgaacgtgagcaaggaggcgcgtgcggccattgccagagct gcgtccgtttttacaatctttgtgacatcctcatcgacggcactggcacacaaacagaac cacaagaccatcacggcaaaggatataatgcagaccctaacggaactggactttgagagt ttcgtgccgtcgctgtcgcaggatctggaagtgtatcgcaaagttgtgaaggacaaaaag gacagcaaggccagcaagaaggatgccagtggtgctgcagatgtctctgccagtggcagt ggagcaaccgaagaggcactttaa

DBGET integrated database retrieval system