Drosophila pseudoobscura: 6896790 Help Entry 6896790           CDS       T01032                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dpo  Drosophila pseudoobscura Pathway dpo04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dpo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     6896790  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dpo04121]     6896790    03400 DNA repair and recombination proteins [BR:dpo03400]     6896790 Ubiquitin system [BR:dpo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      6896790    Cul5 complex      6896790 DNA repair and recombination proteins [BR:dpo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      6896790 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin GABP-alpha Rad60-SLD Motif Other DBs NCBI-GeneID:  6896790 NCBI-ProteinID:  XP_002136995 UniProt:  A0A6I8V1U2 LinkDB All DBs Position 2 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQVVDQRLYNQDNDIMEDDSTLQE YGVTVSTAKAQSPAQLGLTFRNDMGDFETLDMTPYSAPPDLPEVMKNQEASNGQEAVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatcagaaggcaaaagacgacgattttcacggatgcgaaggag aacactaccgttgccgagctgaaacgtatgattgaaggcattctaaaagtacaagtcgtc gatcagcggttatacaaccaggacaacgacattatggaggatgacagcacgttgcaggag tacggcgtgacggtatccacggcgaaggcacagtcgccggcgcaactgggcttgacattc aggaacgatatgggcgactttgaaacactggatatgacgccatactcagctccacccgac ttaccagaagtgatgaaaaaccaagaagcctcaaacggacaggaggcagtcgcataa

DBGET integrated database retrieval system