Drosophila pseudoobscura: 6900389 Help Entry 6900389           CDS       T01032                                  Name (RefSeq) ras-related protein Rac2   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dpo  Drosophila pseudoobscura Pathway dpo04013   MAPK signaling pathway - fly dpo04145   Phagosome dpo04148   Efferocytosis dpo04310   Wnt signaling pathway dpo04620   Toll-like receptor signaling pathway dpo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dpo00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6900389    04310 Wnt signaling pathway     6900389  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6900389    04148 Efferocytosis     6900389  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     6900389  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6900389  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpo04131]     6900389   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpo04147]     6900389    04031 GTP-binding proteins [BR:dpo04031]     6900389 Membrane trafficking [BR:dpo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6900389  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6900389   Macropinocytosis    Ras GTPases     6900389  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6900389 Exosome [BR:dpo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6900389   Exosomal proteins of other body fluids (saliva and urine)    6900389   Exosomal proteins of colorectal cancer cells    6900389   Exosomal proteins of bladder cancer cells    6900389 GTP-binding proteins [BR:dpo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6900389 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  6900389 NCBI-ProteinID:  XP_002134782 UniProt:  B5DQJ0 LinkDB All DBs Position X:complement(43937492..43939748) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSVPIILVGTKLDLR DDKATIEKLKDKKLTPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV VRRPPRRMCKLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgttgttgttggcgacggagccgtgggcaagacctgcctcctg atcagctacacgaccaatgccttccccggagaatacatcccgacggtgttcgataattac tcggccaacgtgatggtggatgccaagcccatcaatctgggactgtgggatacggccggg caggaggactacgatcggttgcgtccgctctcctacccgcagacggacgtcttcctcatc tgcttctcgctggtcaatcccgcctccttcgagaacgtgcgggccaagtggtacccggag gtgcgtcaccactgccccagtgtgccgatcattctggtgggcaccaagctggatctgcgc gatgacaaggccaccatcgagaagctcaaggacaagaagctgacgcccatcacctatccg cagggtctggccatggccaaggagatcggagccgtcaagtatctggagtgctcggctctg acccagaagggcctgaagacggtcttcgacgaggccatccgctcagtgctttgtccggtg gtgcgcaggcccccccgtcgcatgtgcaagctgctgtag

DBGET integrated database retrieval system