Drosophila pseudoobscura: 6900736 Help Entry 6900736           CDS       T01032                                  Name (RefSeq) probable insulin-like peptide 5   KO K04526   insulin Organism dpo  Drosophila pseudoobscura Pathway dpo04068   FoxO signaling pathway dpo04081   Hormone signaling dpo04140   Autophagy - animal dpo04150   mTOR signaling pathway dpo04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:dpo00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     6900736    04150 mTOR signaling pathway     6900736   09133 Signaling molecules and interaction    04081 Hormone signaling     6900736  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     6900736  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     6900736  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dpo04052]     6900736 Cytokines and neuropeptides [BR:dpo04052]  Neuropeptides   Unclassified    6900736 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  6900736 NCBI-ProteinID:  XP_002135096 UniProt:  A0A6I8V0L2 LinkDB All DBs Position X:52497906..52498732 Genome browser AA seq 137 aa AA seqDB search MMAATSTKMQMLVSVLLLLVSLCSWSHGVPSKRSSRLCGDKLSEAMDMMCPNGFNARIPH KRGLLDLFDYVDHMSEPALDDADTADDAAAVGAVLPEGVRLPWRHNSLMSTRRQMRGIVN ECCAKSCTIYEIKAYCK NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgatggccgccacctccaccaagatgcaaatgctagtctccgtgctcctgctgctcgtg tccctctgcagctggagccacggggtgcccagcaagcgatccagcaggctgtgcggcgac aagctgtccgaagccatggacatgatgtgccccaatgggttcaatgcccgaattccccac aagcgcggcttactggatctgttcgattacgtggaccacatgtccgagccggcactggat gatgcggacaccgctgatgatgcggcggccgtgggtgcggtcctgcccgagggtgttcgg ctcccctggcggcacaactccctaatgtctaccaggcgccaaatgcgcggaattgtgaac gaatgttgtgccaagtcgtgcaccatctatgagatcaaggcctactgcaagtga

DBGET integrated database retrieval system