Dreissena polymorpha (zebra mussel): 127848843 Help Entry 127848843         CDS       T08834                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism dpol  Dreissena polymorpha (zebra mussel) Pathway dpol04814   Motor proteins Brite KEGG Orthology (KO) [BR:dpol00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     127848843  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dpol03037]     127848843    04812 Cytoskeleton proteins [BR:dpol04812]     127848843 Cilium and associated proteins [BR:dpol03037]  Motile cilia and associated proteins   Dynein arm    127848843 Cytoskeleton proteins [BR:dpol04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127848843 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 PTP2 RE_TdeIII Motif Other DBs NCBI-GeneID:  127848843 NCBI-ProteinID:  XP_052237466 LinkDB All DBs Position 1:124832371..124842150 Genome browser AA seq 113 aa AA seqDB search MDDFQAAEETAFVVDEVTNIIKEAIEGAIGGNAYQHNKVNQWTSNVVEQCLNQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNQTDGSCTVRWENKTMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgattttcaagctgcagaagagaccgcatttgttgtggatgaagtcactaatata atcaaagaggctattgaaggtgccattggtggaaatgcataccaacataataaagttaac cagtggacttccaatgttgttgaacaatgtttaaaccagctgacaaaacttggcaagcca ttcaaatatattgtgacctgcgtgatcatgcagaagaatggtgcaggtttacatacagct agctcgtgtttctgggacaatcaaacagatgggagctgcactgtgagatgggagaacaaa accatgtactgtatcgtctctgtgttcgggcttgccatctga

DBGET integrated database retrieval system