Dreissena polymorpha (zebra mussel): 127856917 Help Entry 127856917         CDS       T08834                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism dpol  Dreissena polymorpha (zebra mussel) Pathway dpol04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:dpol00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     127856917  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dpol01009]     127856917   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpol04131]     127856917    03036 Chromosome and associated proteins [BR:dpol03036]     127856917   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpol04147]     127856917 Protein phosphatases and associated proteins [BR:dpol01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      127856917 Membrane trafficking [BR:dpol04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     127856917 Chromosome and associated proteins [BR:dpol03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      127856917 Exosome [BR:dpol04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    127856917 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EF_EFCAB10_C EF-hand_9 Dockerin_1 SPARC_Ca_bdg SurA_N_2 Motif Other DBs NCBI-GeneID:  127856917 NCBI-ProteinID:  XP_052249075 LinkDB All DBs Position 14:complement(37462573..37467933) Genome browser AA seq 78 aa AA seqDB search MQKEMDKVSDSSFANDGETVRSAFRTFDRDGNGYIDQKELRVAMKNLGEALTDKELDDMM RQADIDGDGKINYEDSSY NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcagaaagaaatggataaagtcagtgatagttcattcgcaaacgacggcgaaactgtc cgatcagcatttcgaacatttgacagagatggtaatggctacattgatcagaaagaattg agagtagcgatgaaaaatcttggagaggccctaacggacaaggaactagacgatatgatg agacaggctgatatagacggagacggcaaaataaactacgaagattcttcttattag

DBGET integrated database retrieval system