Dreissena polymorpha (zebra mussel): 127857955 Help Entry 127857955         CDS       T08834                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism dpol  Dreissena polymorpha (zebra mussel) Pathway dpol04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:dpol00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     127857955  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dpol01009]     127857955   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpol04131]     127857955    03036 Chromosome and associated proteins [BR:dpol03036]     127857955   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpol04147]     127857955 Protein phosphatases and associated proteins [BR:dpol01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      127857955 Membrane trafficking [BR:dpol04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     127857955 Chromosome and associated proteins [BR:dpol03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      127857955 Exosome [BR:dpol04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    127857955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_9 EH DUF6981 Dockerin_1 DUF5415 EF-hand_11 Motif Other DBs NCBI-GeneID:  127857955 NCBI-ProteinID:  XP_052250697 LinkDB All DBs Position 14:complement(36116633..36127062) Genome browser AA seq 104 aa AA seqDB search MEELLAPIDTDHNGSIDFEEFKKFIIEKDILKSLADEVCYEMKDAFNFFDKDGNGFIDKD ELRKVLTQVGDKMPEEVADDFLREADLNGDGKIDYAEFCKHMGY NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggaggagcttttagcgccgatcgatacagatcacaacgggtctatagacttcgaagag ttcaaaaagttcatcatagagaaggacatcctgaagtctctggctgacgaagtctgttat gagatgaaggacgcgttcaactttttcgacaaagatggtaatgggttcatagataaagac gagctcagaaaagtcctcacgcaagttggcgacaagatgccggaagaagttgcagacgac tttctccgcgaggctgatctgaatggggacggcaaaatagactatgcagaattttgtaag catatgggctactag

DBGET integrated database retrieval system