Dreissena polymorpha (zebra mussel): 127861506 Help Entry 127861506         CDS       T08834                                  Name (RefSeq) elongin-C isoform X1   KO K03872   elongin-C Organism dpol  Dreissena polymorpha (zebra mussel) Pathway dpol04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dpol00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127861506  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dpol04121]     127861506    03400 DNA repair and recombination proteins [BR:dpol03400]     127861506 Ubiquitin system [BR:dpol04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      127861506    Cul5 complex      127861506 DNA repair and recombination proteins [BR:dpol03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      127861506 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  127861506 NCBI-ProteinID:  XP_052256028 LinkDB All DBs Position 16:complement(18050825..18131645) Genome browser AA seq 119 aa AA seqDB search MSDEKGDKGDEEKVYGGCEGPDAMYVKLVSSDGHEFIVKRDHALTSGTIKAMLSGPGQFA ENETNEINFREIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPIAAEIALELLMAANFLDC NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcagatgagaagggggacaaaggcgatgaagagaaggtctatgggggatgtgagggc cctgatgccatgtacgtgaagcttgtctcctctgatggccatgagtttattgttaaaaga gaccacgccttgacttctggaacaattaaagccatgttgagcggcccaggacaatttgca gagaatgaaacaaatgaaattaacttcagagaaataccgtcacacgtcttgcaaaaggtg tgcatgtattttacatataaggttcgatacacaaacagctctactgagataccagagttt cctatagctgcagaaatagcgttggaattactcatggctgccaacttccttgactgttaa

DBGET integrated database retrieval system