Desulfobulbus propionicus: Despr_2010 Help Entry Despr_2010        CDS       T01413                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dpr  Desulfobulbus propionicus Pathway dpr01100   Metabolic pathways dpr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dpr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Despr_2010    00074 Mycolic acid biosynthesis     Despr_2010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Despr_2010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N RRM_PARP14_2 Motif Other DBs NCBI-ProteinID:  ADW18158 UniProt:  A0A7U3YMW1 LinkDB All DBs Position complement(2294768..2295001) Genome browser AA seq 77 aa AA seqDB search MAVEDKMIDIIVEQLSVDRDKVVPGASFVDDLGADSLDLVELIMAMEEEFDVEIPDEEAE KIVTVQNAIDFVAKIQG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccgttgaagataaaatgattgatatcatcgtcgagcaactcagtgttgatcgtgac aaagttgttccgggcgcatcctttgtcgatgacctcggagccgattccctggatctggtc gaactgatcatggccatggaagaggaattcgacgttgaaatccccgacgaagaggccgag aagatcgtcaccgtgcagaatgccatcgatttcgtggccaagattcaaggctga

DBGET integrated database retrieval system