KEGG   Desulfobulbus propionicus: Despr_2822
Entry
Despr_2822        CDS       T01413                                 
Name
(GenBank) lipid A ABC exporter, fused ATPase and inner membrane subunits MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dpr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Despr_2822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpr02000]
    Despr_2822
Enzymes [BR:dpr01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     Despr_2822
Transporters [BR:dpr02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Despr_2822
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_16 AAA ABC_ATPase DEAD nSTAND1 NB-ARC RsgA_GTPase AAA_24 NACHT ATPase_2 AAA_29 AAA_25 nSTAND3 AAA_30 AAA_14 SbcC_Walker_B AAA_33 AAA_18 MobB Cytidylate_kin
Other DBs
NCBI-ProteinID: ADW18956
UniProt: A0A7U4DQ93
LinkDB
Position
complement(3258909..3260654)
AA seq 581 aa
MNNKALFSKLLAVLKPYHAKLLLAMVGMVAVGGFNALQAYMVKPLLDEIFFNRDARLLNL
LPLGLLAIFFFKGIFFFGYSYLLEMVGQSVIRDLRNRIYGHLHELSLSFFHRHPTGELIS
RIMNDVSMLQGSVSHALIRTLRDLCSVVGLLGVIFYMDWRLALISLLFLPAAAVPIVVFG
RKFRRISATYQTKIGEATSQLHETIAGVRIVKAFGMEGFEKQRFGEKMQGIMDTLMLETK
YSCLSHPLIEFLGGIGMAMIIWFGGMQVLQGNSTPGAFMSFLTALIMLYEPVKGVSKINT
TIQQGLAAATRIFSLLDIRPDIQEAERAIELGPFSRSIVFSDVSFHYENNEPVIKHLNLR
VNRGEILAVVGPSGSGKTTLANLIPRFYEVSVGELRIDDVDIREVTFASLRRQIALVSQQ
TILFNDTVRNNIAYGVSDCPEERIVEAARSAYALDFIHELPHGFETVIGEAGARLSGGQQ
QRISIARALLKDAPILILDEATSALDSESEREVQKALENLMRNRTTIVIAHRLSTVHNAD
RIIVLKEGCLIEEGTHDELLALGGEYSFLYRLQFSDQALMR
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaacaataaagcccttttttccaaactactggcagtgctcaagccctatcatgcaaag
ctgttgctggccatggtcggcatggtggccgtgggtggattcaatgccctgcaggcgtac
atggtcaagcccctgttggacgagatttttttcaaccgcgatgcgcgattgctcaacctg
ttgcccctgggcttgctggcgatttttttcttcaaggggattttctttttcggctattcc
tacctgctggaaatggtggggcagagcgtcatccgcgatctgcgcaaccgtatctatggc
catcttcacgaactgtcgctcagttttttccaccggcatccaactggcgagcttatttcg
agaattatgaacgatgtcagcatgttgcagggatctgtttcccatgcgctgattcgcacc
ctccgcgacttgtgctcagtcgtcggactgctcggggtcattttttacatggattggcgg
ctggccctgatttccctgctttttctgccggcagccgcggtgccgatcgttgtttttggc
agaaaattcagaaggatcagtgcgacctatcagaccaagatcggcgaagcgaccagccag
ctgcacgaaaccattgccggggtgcgcatcgtcaaggcctttggcatggaagggttcgag
aagcaacgctttggcgagaagatgcagggtatcatggacaccctgatgctggaaaccaag
tacagctgcctctcccaccccctgatcgagttcctcggcggcatcggcatggcgatgatc
atctggttcggcggcatgcaggtcctgcagggcaactcgacaccaggtgccttcatgtcc
tttctcaccgccttgatcatgctctatgaaccggtcaagggcgttagcaaaatcaacacc
accattcagcagggattggcggcggccacgcgcattttttccctgctggatatccggccc
gatatccaggaagctgagcgggccattgagctggggccgttcagccgcagcatcgtgttt
tcggacgtcagcttccactacgagaacaacgagccggtgatcaaacacctcaacttgcgg
gtcaaccggggcgaaatcctggcggtggtcggcccgagcggcagcggcaagacaaccttg
gccaacctgattccgaggttttacgaggtcagcgtgggcgagctgcgcatcgatgacgtc
gatatccgcgaggtcacctttgcctccctgcgccggcagatcgccctggtcagccagcag
accatcctgttcaacgatacggtgcgcaacaatatcgcctatggggtcagtgactgccca
gaggagcggattgtcgaggcggcccgatcggcctatgccctggatttcatccatgaactg
ccccatgggttcgagacggtgatcggtgaagccggcgcccggctgtcaggcggacagcag
cagcggatctccattgcccgagccctgctcaaggacgcaccgatcctgatccttgacgaa
gcaacctcggccctggacagcgaatcggaacgtgaagtacaaaaggccctggaaaacctg
atgcgcaaccgaaccaccattgtgatcgctcatcgattgtccacggtgcacaacgcggat
cggatcattgtcctcaaagaggggtgcctgattgaagaaggtacccacgatgaattgctg
gccttgggtggtgagtacagttttctttatcgtctgcagttttccgatcaagcactgatg
agataa

DBGET integrated database retrieval system