Desulfotalea psychrophila: DP2093 Help Entry DP2093            CDS       T00192                                  Name (GenBank) related to acyl carrier protein   KO K02078   acyl carrier protein Organism dps  Desulfotalea psychrophila Pathway dps01100   Metabolic pathways dps01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dps00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DP2093    00074 Mycolic acid biosynthesis     DP2093   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DP2093 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAG36822 UniProt:  Q6ALF3 LinkDB All DBs Position complement(2384079..2384324) Genome browser AA seq 81 aa AA seqDB search MRKEQIKETILRALQPITPEADLDGLAADENMQDALDIDSFDVLTFFVKLYEELGVEIPE EDYGQIITLNDLIGYLAARID NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagaaaagagcaaatcaaagagaccatcctccgggccctgcaaccaatcacccccgaa gccgatttagatgggttggctgccgacgagaacatgcaggatgccctcgacatcgactct tttgatgtcctcacttttttcgtcaagctctatgaagaactcggggtggaaattccagag gaggactatggacagatcattaccctaaacgacctcatcggctacctcgctgcccgcatc gactga

DBGET integrated database retrieval system