Desulfotalea psychrophila: DP2404 Help Entry DP2404            CDS       T00192                                  Name (GenBank) similar to acyl carrier protein   KO K02078   acyl carrier protein Organism dps  Desulfotalea psychrophila Pathway dps01100   Metabolic pathways dps01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dps00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DP2404    00074 Mycolic acid biosynthesis     DP2404   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DP2404 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding VapC50_C Motif Other DBs NCBI-ProteinID:  CAG37133 UniProt:  Q6AKJ2 LinkDB All DBs Position 2747434..2747685 Genome browser AA seq 83 aa AA seqDB search MTNEEIKDLILEIIEDIDDEAEFEGLNPDEPLRDQLDLDSMDFLDIVMELRKRHQLQIPE EDYPQLASLSSCVVYLAPLLKDA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactaacgaagaaatcaaagatttgatccttgaaattatcgaagatatagatgacgaa gctgaatttgagggccttaacccggatgagcctctgcgagatcaacttgacctcgattca atggattttctcgatattgttatggaactccgcaagcgtcatcaactccaaatcccagaa gaggactacccacaacttgcctcactatcaagctgtgttgtctaccttgctcctctgctc aaagacgcatag

DBGET integrated database retrieval system