Desulfotalea psychrophila: DPPB41 Help Entry DPPB41            CDS       T00192                                  Name (GenBank) Predicted orf   KO K02078   acyl carrier protein Organism dps  Desulfotalea psychrophila Pathway dps01100   Metabolic pathways dps01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dps00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DPPB41    00074 Mycolic acid biosynthesis     DPPB41   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DPPB41 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  CAG37905 UniProt:  Q6AIE2 LinkDB All DBs Position large:42550..42795 Genome browser AA seq 81 aa AA seqDB search MTEEQIKQTILRVLQPITPEADLDELAADEDMQEALDIDSFDVLTFFVKLYEELGVEIPE EDYGQIITLNDLIGYLAARID NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacagaagagcaaatcaaacagaccatcctccgggtcctgcagccaatcacccccgaa gccgatttagatgagttggctgccgacgaggacatgcaggaggccctggacatcgactct tttgatgtcctcacttttttcgtcaagctctatgaagaactcggggtggaaattccagag gaggactatggacagatcattaccctaaacgacctcatcggctacctcgctgcccgcatc gactga

DBGET integrated database retrieval system