Deinococcus proteolyticus: Deipr_1796 Help Entry Deipr_1796        CDS       T01426                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism dpt  Deinococcus proteolyticus Pathway dpt01100   Metabolic pathways dpt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dpt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Deipr_1796    00074 Mycolic acid biosynthesis     Deipr_1796   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Deipr_1796 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ADY26928 UniProt:  F0RLK4 LinkDB All DBs Position complement(1915282..1915512) Genome browser AA seq 76 aa AA seqDB search MAIFDDVKEVIVEKLGADADQVTPEARFVEDLGADSLEIVELVMGLEDKFGLTISDEDAE GIRTVQAAVDYVEKNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctatttttgatgacgttaaagaagtgatcgtagagaagctgggcgccgacgctgac caggtgacccccgaagcccgcttcgtggaagacctgggcgccgacagcctggaaatcgtg gaactggtgatgggtctggaagacaagttcggcctgaccatcagcgacgaagacgccgaa ggcatccgcaccgttcaggcggctgtggactacgtcgagaagaaccagtaa

DBGET integrated database retrieval system