Deinococcus puniceus: SU48_01530 Help Entry SU48_01530        CDS       T04339                                  Name (GenBank) exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism dpu  Deinococcus puniceus Pathway dpu03430   Mismatch repair Brite KEGG Orthology (KO) [BR:dpu00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     SU48_01530  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:dpu03400]     SU48_01530 Enzymes [BR:dpu01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      SU48_01530 DNA repair and recombination proteins [BR:dpu03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      SU48_01530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF2019 Motif Other DBs NCBI-ProteinID:  ANE42658 UniProt:  A0A172T6K5 LinkDB All DBs Position 315094..315351 Genome browser AA seq 85 aa AA seqDB search MPDVSSPLAYRDAYAKLSRIAAELESGEADLDRVLPLLEEAKAAYAACHERIEAVRAVLA GSWGAEVAGADAEQDDADDATDDPY NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcctgacgtttcttccccgctggcctaccgcgacgcctacgcgaaattgtcgcggatt gccgccgaactggaatcgggcgaggccgacttagaccgcgtgttgccgctgttggaggaa gccaaagccgcctacgccgcttgccatgagcgcatagaggcggtgcgggcggtgctggct ggaagctggggcgcggaggttgccggagcagatgcggagcaggacgacgcggacgacgcc acggatgacccgtattga

DBGET integrated database retrieval system