Deinococcus puniceus: SU48_04835 Help Entry SU48_04835        CDS       T04339                                  Name (GenBank) primosome subunit DnaD   KO K03116   sec-independent protein translocase protein TatA Organism dpu  Deinococcus puniceus Pathway dpu03060   Protein export dpu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:dpu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SU48_04835  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SU48_04835  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:dpu02044]     SU48_04835 Secretion system [BR:dpu02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SU48_04835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANE43199 UniProt:  A0A172T845 LinkDB All DBs Position 1050901..1051158 Genome browser AA seq 85 aa AA seqDB search MPNIGPAEIMLILLVALVVFGPRKLPELGKSLGHGLREFRKGTSGLKAELDGGLREPVPA PVVMDAQPVAAAVAPTAVTPRAPQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccaatatcggccccgctgaaattatgttgattctgctcgttgcactggttgttttt ggcccccgcaagctgcccgaactgggcaagagcctcggtcacggcctgcgcgaattccgc aagggaacgtctggcctgaaggctgaactggacggcggcctgcgtgagcctgtgcccgcg cctgtggtcatggacgcccagccggttgccgctgctgtcgctcccaccgccgtgactccc cgcgctcctcaggcctaa

DBGET integrated database retrieval system