Dryobates pubescens (Downy woodpecker): 104296307 Help Entry 104296307         CDS       T08526                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04010   MAPK signaling pathway dpub04012   ErbB signaling pathway dpub04068   FoxO signaling pathway dpub04137   Mitophagy - animal dpub04140   Autophagy - animal dpub04150   mTOR signaling pathway dpub04210   Apoptosis dpub04218   Cellular senescence dpub04370   VEGF signaling pathway dpub04371   Apelin signaling pathway dpub04540   Gap junction dpub04625   C-type lectin receptor signaling pathway dpub04810   Regulation of actin cytoskeleton dpub04910   Insulin signaling pathway dpub04912   GnRH signaling pathway dpub04916   Melanogenesis Brite KEGG Orthology (KO) [BR:dpub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104296307 (NRAS)    04012 ErbB signaling pathway     104296307 (NRAS)    04370 VEGF signaling pathway     104296307 (NRAS)    04371 Apelin signaling pathway     104296307 (NRAS)    04068 FoxO signaling pathway     104296307 (NRAS)    04150 mTOR signaling pathway     104296307 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104296307 (NRAS)    04137 Mitophagy - animal     104296307 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104296307 (NRAS)    04218 Cellular senescence     104296307 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104296307 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104296307 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104296307 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104296307 (NRAS)    04912 GnRH signaling pathway     104296307 (NRAS)    04916 Melanogenesis     104296307 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dpub04131]     104296307 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpub04147]     104296307 (NRAS)    04031 GTP-binding proteins [BR:dpub04031]     104296307 (NRAS) Membrane trafficking [BR:dpub04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104296307 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104296307 (NRAS) Exosome [BR:dpub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104296307 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104296307 (NRAS)   Exosomal proteins of breast cancer cells    104296307 (NRAS)   Exosomal proteins of colorectal cancer cells    104296307 (NRAS) GTP-binding proteins [BR:dpub04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104296307 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc RsgA_GTPase GTP_EFTU FeoB_N Arf Motif Other DBs NCBI-GeneID:  104296307 NCBI-ProteinID:  XP_009894396 LinkDB All DBs Position Unknown AA seq 159 aa AA seqDB search GGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQEYSAMRDQYMRTGEGFLCVFAINNSKSF ADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQ GVEDAFYTLVREIRQYRMKKLNSNEDGNQGCMGLSCVVM NT seq 480 nt NT seq  +upstreamnt  +downstreamnt ggtggcgtcggcaagagcgcgctgaccatccagctcatccagaaccacttcgtggacgaa tacgaccccaccatcgaggattcatacagaaagcaggagtacagcgccatgcgtgatcag tacatgagaacaggggaagggttcctctgtgtgtttgccattaacaacagtaaatccttt gctgatattaacctttacagagaacagatcaagagagtgaaagattcggatgatgtgcca atggtgctagttgggaataagtgtgatttgcccacaagaacagtagacacaaaacaggct caagaattagctaaaagctatggaatccccttcatagagacatctgctaaaacaagacag ggtgtggaagatgctttttacacgctggtgcgggagatccggcagtaccggatgaaaaag ctcaacagcaacgaagatgggaatcaaggctgcatgggactgtcctgcgttgtgatgtga

DBGET integrated database retrieval system