Dryobates pubescens (Downy woodpecker): 104296797 Help Entry 104296797         CDS       T08526                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub04382   Cornified envelope formation dpub05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dpub00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104296797 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104296797 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpub04147]     104296797 (S100A10) Exosome [BR:dpub04147]  Exosomal proteins   Exosomal proteins of microglial cells    104296797 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 Motif Other DBs NCBI-GeneID:  104296797 NCBI-ProteinID:  XP_009894947 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MTATPTRLGNQRDPMALDKIMKDLDQCRDGRVGFQGFFSLVAGLTIACNDYFVLHMKQKG RK NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgacagcgacgccaacaaggctgggaaaccagagggaccccatggccctggacaagatc atgaaggacctggaccagtgccgggacggccgcgtgggcttccagggcttcttctcgctg gtggccgggctgaccatcgcctgcaacgactacttcgtgctgcacatgaagcagaagggc aggaagtga

DBGET integrated database retrieval system