Dryobates pubescens (Downy woodpecker): 104296960 Help Entry 104296960         CDS       T08526                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub03030   DNA replication dpub03082   ATP-dependent chromatin remodeling dpub03410   Base excision repair dpub03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dpub00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     104296960 (POLE3)    03410 Base excision repair     104296960 (POLE3)    03420 Nucleotide excision repair     104296960 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104296960 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dpub03032]     104296960 (POLE3)    03036 Chromosome and associated proteins [BR:dpub03036]     104296960 (POLE3)    03400 DNA repair and recombination proteins [BR:dpub03400]     104296960 (POLE3) Enzymes [BR:dpub01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      104296960 (POLE3) DNA replication proteins [BR:dpub03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     104296960 (POLE3) Chromosome and associated proteins [BR:dpub03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     104296960 (POLE3) DNA repair and recombination proteins [BR:dpub03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       104296960 (POLE3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone RNA_pol_3_Rpc31 SpoU_methylase BUD22 Myc_N DUF4746 PFF1_TM NOA36 O-antigen_lig Pox_Ag35 Afi1 CDC45 CobT ECM10 TPR_TTI1_C Motif Other DBs NCBI-GeneID:  104296960 NCBI-ProteinID:  XP_009895128 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MPLPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNAGDVLSAMEEMEFQR FVAPLKESLEVYRREQRGKKEARKDKDKKTDSEEQDKSREEENEDEDERMEEEEQNDEEE VDN NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgccgcttcctgatggggtgaacatctccaaagaagctcggagcgcgatatcccgggca gcgagcgtctttgtgctctatgccacatcatgtgccaataactttgccatgaaggggaag aggaagacgctgaacgccggcgatgttctctctgccatggaggagatggagttccagcga ttcgtcgcccctctgaaggagtccctggaagtttacaggcgcgagcagagagggaagaaa gaagcgaggaaggacaaggacaagaagacagactcggaggagcaggataagagccgagag gaagagaatgaggatgaggatgaaaggatggaggaagaagagcaaaatgatgaggaagag gtggacaactga

DBGET integrated database retrieval system