KEGG Orthology (KO) [BR:dpub00001]
09100 Metabolism
09104 Nucleotide metabolism
00240 Pyrimidine metabolism
104297329 (DUT)
09111 Xenobiotics biodegradation and metabolism
00983 Drug metabolism - other enzymes
104297329 (DUT)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:dpub03400]
104297329 (DUT)
Enzymes [BR:dpub01000]
3. Hydrolases
3.6 Acting on acid anhydrides
3.6.1 In phosphorus-containing anhydrides
3.6.1.23 dUTP diphosphatase
104297329 (DUT)
DNA repair and recombination proteins [BR:dpub03400]
Eukaryotic type
Other factors with a suspected DNA repair function
Modulation of nucleotide pools
104297329 (DUT)
Prokaryotic type
104297329 (DUT)
166 aa
MPSSEVVLQPSPSKRQKGSVPGEPAARLRFAKLSENACTPSRGSARAAGYDLYSAYDCVI
PPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGK
EAFEVKKGDRIAQLICERICYPELEEVQALDDTERGEGGFGSTGKN