Dryobates pubescens (Downy woodpecker): 104298451 Help Entry 104298451         CDS       T08526                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism dpub  Dryobates pubescens (Downy woodpecker) Pathway dpub03082   ATP-dependent chromatin remodeling dpub04217   Necroptosis Brite KEGG Orthology (KO) [BR:dpub00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104298451  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104298451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dpub03036]     104298451   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dpub04147]     104298451 Chromosome and associated proteins [BR:dpub03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104298451 Exosome [BR:dpub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104298451 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  104298451 NCBI-ProteinID:  XP_009896819 UniProt:  A0A093G9N1 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctgggcgcgggaagcaaggcgggaaggctcgggccaaggccaagtcgcgctcctca cgggccggcctccagttccccgtgggccgtgtccaccgactgctgcgcaagggtaactat gcagagcgagtgggtgctggagccccggtgtacctggcggccgtgctggagtacctgact gctgaaatcctggagctggcaggcaacgctgcccgcgacaacaagaagacgcgcatcatt ccccgccacttgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgacgatcgcgcagggcggagtgctgcccaacatccaggccgtgctgctgcccaagaag actgagagtcacaaggcaaagagcaagtaa

DBGET integrated database retrieval system